Loading...
Statistics
Advertisement

a mum and other things – my musings as a mum on Mount Macedon… and ...
www.amumandotherthings.com/
my musings as a mum on Mount Macedon... and other things

Amumandotherthings.com

Advertisement
Amumandotherthings.com is hosted in United States / San Francisco . Amumandotherthings.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Amumandotherthings.com

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 2
  • Facebook Box
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Amumandotherthings.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 305824697402169823231304834028145237636840
    • validFrom: 160404105900Z
    • validTo: 160703105900Z
    • validFrom_time_t: 1459767540
    • validTo_time_t: 1467543540
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Amumandotherthings.com

Number of occurences: 10
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: application-name
    Content: a mum and other things
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: my musings as a mum on Mount Macedon... and other things
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: a mum and other things on WordPress.com
  • Name: description
    Content: my musings as a mum on Mount Macedon... and other things

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns1.wordpress.com
  • ns2.wordpress.com
  • ns3.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sun, 15 May 2016 22:46:19 GMT Content-Type: text/html Content-Length: 178 Location: https://amumandotherthings.com/ X-ac: 3.bur _bur X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sun, 15 May 2016 22:46:21 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.bur _bur

DNS

host: amumandotherthings.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: amumandotherthings.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: amumandotherthings.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: amumandotherthings.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: amumandotherthings.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: amumandotherthings.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.mumandotherthings.com, www.aomumandotherthings.com, www.omumandotherthings.com, www.apmumandotherthings.com, www.pmumandotherthings.com, www.a9mumandotherthings.com, www.9mumandotherthings.com, www.amumandotherthings.com, www.mumandotherthings.com, www.aimumandotherthings.com, www.imumandotherthings.com, www.aumumandotherthings.com, www.umumandotherthings.com, www.aumandotherthings.com, www.ampumandotherthings.com, www.apumandotherthings.com, www.amoumandotherthings.com, www.aoumandotherthings.com, www.amiumandotherthings.com, www.aiumandotherthings.com, www.amkumandotherthings.com, www.akumandotherthings.com, www.am.umandotherthings.com, www.a.umandotherthings.com, www.amuumandotherthings.com, www.auumandotherthings.com, www.amjumandotherthings.com, www.ajumandotherthings.com, www.amnumandotherthings.com, www.anumandotherthings.com, www.am-umandotherthings.com, www.a-umandotherthings.com, www.ammandotherthings.com, www.amuwmandotherthings.com, www.amwmandotherthings.com, www.amuemandotherthings.com, www.amemandotherthings.com, www.amusmandotherthings.com, www.amsmandotherthings.com, www.amuamandotherthings.com, www.amamandotherthings.com, www.amuandotherthings.com, www.amumpandotherthings.com, www.amupandotherthings.com, www.amumoandotherthings.com, www.amuoandotherthings.com, www.amumiandotherthings.com, www.amuiandotherthings.com, www.amumkandotherthings.com, www.amukandotherthings.com, www.amum.andotherthings.com, www.amu.andotherthings.com, www.amumuandotherthings.com, www.amuuandotherthings.com, www.amumjandotherthings.com, www.amujandotherthings.com, www.amumnandotherthings.com, www.amunandotherthings.com, www.amum-andotherthings.com, www.amu-andotherthings.com, www.amumndotherthings.com, www.amumaondotherthings.com, www.amumondotherthings.com, www.amumapndotherthings.com, www.amumpndotherthings.com, www.amuma9ndotherthings.com, www.amum9ndotherthings.com, www.amumandotherthings.com, www.amumndotherthings.com, www.amumaindotherthings.com, www.amumindotherthings.com, www.amumaundotherthings.com, www.amumundotherthings.com, www.amumadotherthings.com, www.amumanndotherthings.com, www.amumandotherthings.com, www.amumanhdotherthings.com, www.amumahdotherthings.com, www.amumanjdotherthings.com, www.amumajdotherthings.com, www.amumankdotherthings.com, www.amumakdotherthings.com, www.amumanldotherthings.com, www.amumaldotherthings.com, www.amuman dotherthings.com, www.amuma dotherthings.com, www.amumanotherthings.com, www.amumandtotherthings.com, www.amumantotherthings.com, www.amumandgotherthings.com, www.amumangotherthings.com, www.amumandbotherthings.com, www.amumanbotherthings.com, www.amumandxotherthings.com, www.amumanxotherthings.com, www.amumandsotherthings.com, www.amumansotherthings.com, www.amumandfotherthings.com, www.amumanfotherthings.com, www.amumandvotherthings.com, www.amumanvotherthings.com, www.amumandyotherthings.com, www.amumanyotherthings.com, www.amumandzotherthings.com, www.amumanzotherthings.com, www.amumandaotherthings.com, www.amumanaotherthings.com, www.amumandeotherthings.com, www.amumaneotherthings.com, www.amumandrotherthings.com, www.amumanrotherthings.com, www.amumandtherthings.com, www.amumandobtherthings.com, www.amumandbtherthings.com, www.amumandohtherthings.com, www.amumandhtherthings.com, www.amumandogtherthings.com, www.amumandgtherthings.com, www.amumandojtherthings.com, www.amumandjtherthings.com, www.amumandomtherthings.com, www.amumandmtherthings.com, www.amumando therthings.com, www.amumand therthings.com, www.amumandovtherthings.com, www.amumandvtherthings.com, www.amumandoherthings.com, www.amumandotqherthings.com, www.amumandoqherthings.com, www.amumandotaherthings.com, www.amumandoaherthings.com, www.amumandot herthings.com, www.amumando herthings.com, www.amumandotwherthings.com, www.amumandowherthings.com, www.amumandoteherthings.com, www.amumandoeherthings.com, www.amumandotzherthings.com, www.amumandozherthings.com, www.amumandotxherthings.com, www.amumandoxherthings.com, www.amumandotcherthings.com, www.amumandocherthings.com, www.amumandoterthings.com, www.amumandotheerthings.com, www.amumandoteerthings.com, www.amumandothderthings.com, www.amumandotderthings.com, www.amumandothcerthings.com, www.amumandotcerthings.com, www.amumandothuerthings.com, www.amumandotuerthings.com, www.amumandothjerthings.com, www.amumandotjerthings.com, www.amumandotherthings.com, www.amumandoterthings.com, www.amumandothberthings.com, www.amumandotberthings.com, www.amumandothgerthings.com, www.amumandotgerthings.com, www.amumandothrthings.com, www.amumandothexrthings.com, www.amumandothxrthings.com, www.amumandothesrthings.com, www.amumandothsrthings.com, www.amumandothewrthings.com, www.amumandothwrthings.com, www.amumandotherrthings.com, www.amumandothrrthings.com, www.amumandothefrthings.com, www.amumandothfrthings.com, www.amumandothevrthings.com, www.amumandothvrthings.com, www.amumandothecrthings.com, www.amumandothcrthings.com, www.amumandotheqrthings.com, www.amumandothqrthings.com, www.amumandothearthings.com, www.amumandotharthings.com, www.amumandotheyrthings.com, www.amumandothyrthings.com,

Other websites we recently analyzed

  1. vyde.info
    Switzerland - 141.8.225.31
    Server software: Apache
    Technology: Html
  2. Montana's Smokehouse
    restaurant, bbq, smokehouse, breakfast, brunch, dinner, dj, nightlife, barbeque, drinks, beer, bar, martini, mixed drinks, dancing, club, dance music, Hip Hop, Trap, House, Breaks, Remix, food, breakfast, lunch, dinner, appetizers, hotwings, ribs, brisket, beef, salads, bbq sauce, cole slaw, fried okra, french fries, catfish, shrimp, great service, home made, blackened, baked, fried, chicken, pork, vegetables,
    New York (United States) - 198.185.159.145
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, Google Analytics, Squarespace
    Number of Javascript: 2
    Number of meta tags: 8
  3. Bradford Financial - We help you plan for the future by providing quality financial planning advice and products through a network of Consultants.
    Canada - 104.153.57.70
    Server software: nginx/1.9.6
    Technology: CSS, Google Font API, Html, Iframe, Javascript, jQuery, Google Analytics, Google Tagmanager, New Relic, Liferay
    Number of Javascript: 16
    Number of meta tags: 4
  4. petacures.com | Pedicures
    Kirkland (United States) - 98.124.245.24
    Server software: Apache/2.2.15 (CentOS)
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 3
  5. xihudaxue.com
    New York (United States) - 199.59.243.120
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, Html, Html5, Javascript
    Number of meta tags: 2
  6. www.qghy.cn的域名信息。 www.qghy.cn's information.
    San Jose (United States) - 137.175.6.121
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 1
  7. Best Online Leadership Tools Right When You Need Them
    The best online leadership tools to propel you and your team quickly and easily toward your goals
    Montréal (Canada) - 66.43.59.149
    Server software: Apache
    Technology: CSS, Html, Javascript, PageSpeed Module, Php, Facebook Box
    Number of Javascript: 2
    Number of meta tags: 3
  8. Welcome
    Scottsdale (United States) - 72.167.191.69
    Server software: DPS/0.2.7
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 2
    Number of meta tags: 2
  9. Салон красоты Фифа Киев Осокорки, парикмахерская, наращивание, ресниц, маникюр, педикюр, шугаринг, татуаж бровей, микропигментация, массаж Ð
    Салон красоты Фифа, находится по адресу: г. Киев, ул. Елизаветы Чавдар, 2. (м. Осокорки, м. Позняки) Салон красоты оказывает профессиональные и качественные услуги в сфере красоты и ухода за собой. Наши профессионалы смогут подобрать Ваш стиль, улцчшить внешний вид кожи, сделать современную и аккуратную прическу. Работаем с 9-00до 21-00
    Germany - 213.239.227.58
    Server software: nginx
    Technology: CSS, Html, Iframe, Php, Yandex.Metrika
    Number of Javascript: 8
    Number of meta tags: 4
  10. UTG
    Turkey - 93.187.204.40
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery Colorbox, jQuery Cookie
    Number of Javascript: 9
    Number of meta tags: 3

Check Other Websites